Retatrutide

Mechanism: Retatrutide maps multi-receptor metabolic adaptation by concurrently stimulating insulin secretion via GIP/GLP-1 while activating glucagon receptors to upregulate lipolysis and mitochondrial thermogenesis.

Sequence: YSQGTFTSDYSKYLDSKKAKEFVEWLLAEGQGGPSSGAPPPS

Recommended Dosage: Starting test parameter is 2mg administered once weekly. Titration steps increase by 2mg every 4 weeks. Maximum observed plateau dosing is 12mg per week.

Tracking Cycle: Standard research timelines range from 12 to 24 weeks to observe complete physiological steady-state tracking.